PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3226_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family S1Fa-like
Protein Properties Length: 84aa    MW: 9142.03 Da    PI: 10.5256
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3226_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA134.72.3e-421884470
        S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                a++eakGlnPGlivllv+gg+l+vflv+n ++yvyaqknlPPr+kkPvskkklkreklkqGv+vPGe
  RrC3226_p3 18 AAAEAKGLNPGLIVLLVIGGPLVVFLVANCVMYVYAQKNLPPRRKKPVSKKKLKREKLKQGVSVPGE 84
                789***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.8E-372084IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MQHAYQKDES ILGLVCTAAA EAKGLNPGLI VLLVIGGPLV VFLVANCVMY VYAQKNLPPR  60
RKKPVSKKKL KREKLKQGVS VPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892692e-81AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.15e-23DNA-binding protein S1FA1
SwissprotQ423379e-19S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA36e-23W9SCA3_9R
STRINGBra006994.1-P2e-17(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769